Iright
BRAND / VENDOR: Proteintech

Proteintech, 86470-1-RR, NDUFA1 Recombinant monoclonal antibody

CATALOG NUMBER: 86470-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NDUFA1 (86470-1-RR) by Proteintech is a Recombinant antibody targeting NDUFA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 86470-1-RR targets NDUFA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A-673 cells, SK-BR-3 cells, PANC-1 cells, Ramos cells, HeLa cells, mouse heart tissue, rat heart tissue Positive IHC detected in: mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information NDUFA1, also known as NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, it's part of the NADH dehydrogenase (ubiquinone) 1 alpha subcomplex. The NDUFA1 gene encoding the MWFE polypeptide is located on the X chromosome. The NDUFA1 gene product (MWFE protein) is essential for activity of complex I in mammalian mitochondria, and it is predicted to be a membrane protein (PMID: 10200266). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7206 Product name: Recombinant human NDUFA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC000266 Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa Calculated Molecular Weight: 7.5 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC000266 Gene Symbol: NDUFA1 Gene ID (NCBI): 4694 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15239 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924