Iright
BRAND / VENDOR: Proteintech

Proteintech, 86484-1-RR, B7-H4 Recombinant monoclonal antibody

CATALOG NUMBER: 86484-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The B7-H4 (86484-1-RR) by Proteintech is a Recombinant antibody targeting B7-H4 in WB, ELISA applications with reactivity to mouse, rat samples 86484-1-RR targets B7-H4 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, rat uterus tissue, rat pancreas tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information B7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3230 Product name: Recombinant Rat B7-H4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-257 aa of NM_001024244.1 Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG Predict reactive species Full Name: V-set domain containing T cell activation inhibitor 1 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_001024244.1 Gene Symbol: Vtcn1 Gene ID (NCBI): 295322 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q501W4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924