Iright
BRAND / VENDOR: Proteintech

Proteintech, 86496-1-RR, TRIM29 Recombinant monoclonal antibody

CATALOG NUMBER: 86496-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TRIM29 (86496-1-RR) by Proteintech is a Recombinant antibody targeting TRIM29 in WB, ELISA applications with reactivity to human samples 86496-1-RR targets TRIM29 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HT-29 cells, HaCaT cells, BGC-823 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TRIM29(Tripartite motif-containing protein 29) is also named as ATDC( Ataxia telangiectasia group D-associated protein). ATDC protein physically interacted with the intermediate filament protein vimentin, a protein kinase C substrate and colocalizing protein, and with an inhibitor of protein kinase C, PKCI1 (PMID:7644499). Knockdown of TRIM29 in airway epithelial cells enhances type I interferon production, and in human nasopharyngeal carcinoma cells results in almost complete Epstein-Barr virus clearance. TRIM29 is also highly induced by cytosolic double-stranded DNA in myeloid dendritic cells (PMID: 29038422). Western detected both full-length TRIM29 (65 kDa) and a truncated variant of TRIM29 with a molecular weight of about 50 kDa (PMID: 26095369). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11600 Product name: Recombinant human TRIM29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-588 aa of BC017352 Sequence: DQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP Predict reactive species Full Name: tripartite motif-containing 29 Calculated Molecular Weight: 588 aa, 66 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC017352 Gene Symbol: TRIM29 Gene ID (NCBI): 23650 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14134 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924