Proteintech, 86500-2-RR, APOD Recombinant monoclonal antibody

Size: 20ul / 100ul The APOD (86500-2-RR) by Proteintech is a Recombinant antibody targeting APOD in WB, IF/ICC, ELISA applications with reactivity to human samples 86500-2-RR targets APOD in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0812 Product name: Recombinant human APOD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-189 aa of BC007402 Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS Predict reactive species Full Name: apolipoprotein D Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 21-33 kDa GenBank Accession Number: BC007402 Gene Symbol: APOD Gene ID (NCBI): 347 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05090 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.