Iright
BRAND / VENDOR: Proteintech

Proteintech, 86504-3-RR, PBX1 Recombinant monoclonal antibody

CATALOG NUMBER: 86504-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PBX1 (86504-3-RR) by Proteintech is a Recombinant antibody targeting PBX1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86504-3-RR targets PBX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-12 cells, NIH/3T3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PBX1, also named as Pre-B-cell leukemia transcription factor 1, is a 430 amino acid protein, which belongs to the TALE/PBX homeobox family. PBX1 is expressed in all tissues except in cells of the B and T lineage. PBX1 acts as a transcriptional activator of PF4 in complex with MEIS1. PBX1 may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBX1b as part of a PDX1:PBX1b: MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer. PBX1 exists two isoforms (PBX1a and PBX1b), and molecular weight of PBX1 is 47 kDa and 38 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12817 Product name: Recombinant human PBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC101578 Sequence: MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMS Predict reactive species Full Name: pre-B-cell leukemia homeobox 1 Calculated Molecular Weight: 430 aa, 47 kDa Observed Molecular Weight: 38 kDa, 47 kDa GenBank Accession Number: BC101578 Gene Symbol: PBX1 Gene ID (NCBI): 5087 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40424 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924