Proteintech, 86506-1-RR, NAGK Recombinant monoclonal antibody

Size: 20ul / 100ul The NAGK (86506-1-RR) by Proteintech is a Recombinant antibody targeting NAGK in WB, ELISA applications with reactivity to human samples 86506-1-RR targets NAGK in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A2780 cells, A549 cells, MCF-7 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information NAGK, also called N-acetylglucosamine kinase, or GlcNAc kinase, converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. NAGK can suppress the formation of α-syn A53T aggregates in neuronal and non-neuronal cells and suggest aggregation suppression is a general function of NAGK (PMID: 32796833). NAGK is broadly expressed in immune cells and has previously been described to contribute to the hexosamine biosynthetic salvage pathway (PMID: 36002575). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7034 Product name: Recombinant human NAGK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC001029 Sequence: MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS Predict reactive species Full Name: N-acetylglucosamine kinase Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC001029 Gene Symbol: NAGK Gene ID (NCBI): 55577 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UJ70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.