Iright
BRAND / VENDOR: Proteintech

Proteintech, 86509-1-RR, F2RL3 Recombinant monoclonal antibody

CATALOG NUMBER: 86509-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The F2RL3 (86509-1-RR) by Proteintech is a Recombinant antibody targeting F2RL3 in WB, ELISA applications with reactivity to human, mouse, rat samples 86509-1-RR targets F2RL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Coagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4 (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13624 Product name: Recombinant human F2RL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-385 aa of BC074782 Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ Predict reactive species Full Name: coagulation factor II (thrombin) receptor-like 3 Calculated Molecular Weight: 385 aa, 41 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC074782 Gene Symbol: F2RL3 Gene ID (NCBI): 9002 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96RI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924