Proteintech, 86511-3-RR, FABP3 Recombinant monoclonal antibody

Size: 20ul / 100ul The FABP3 (86511-3-RR) by Proteintech is a Recombinant antibody targeting FABP3 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 86511-3-RR targets FABP3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, mouse skeletal muscle tissue, human heart tissue, mouse heart tissue, rat heart tissue, pig heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1069 Product name: Recombinant human FABP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species Full Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC007021 Gene Symbol: FABP3 Gene ID (NCBI): 2170 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05413 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.