Proteintech, 86549-1-RR, Citrate synthase Recombinant monoclonal antibody

Size: 20ul / 100ul The Citrate synthase (86549-1-RR) by Proteintech is a Recombinant antibody targeting Citrate synthase in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86549-1-RR targets Citrate synthase in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, mouse heart tissue, Jurkat cells, K-562 cells, HepG2 cells, NIH/3T3 cells, HSC-T6 cells Positive IF/ICC detected in: HepG2 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Citrate synthase (CS), the first and rate-limiting enzyme of the tricarboxylic acid cycle, plays a key role in regulating energy generation of mitochondrial respiration(PMID:19479947).It belongs to the citrate synthase family. The deduced 466-amino acid protein contains an N-terminal mitochondrial targeting sequence and a motif highly conserved in citrate synthases(PMID:12549038). It can exsit as a dimer(PMID:8749851). Northern blot analysis detected no CS expression in thymus and small intestine(PMID:12549038). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9117 Product name: Recombinant human CS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-466 aa of BC010106 Sequence: EQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG Predict reactive species Full Name: citrate synthase Calculated Molecular Weight: 466 aa, 52 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC010106 Gene Symbol: Citrate Synthase Gene ID (NCBI): 1431 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75390 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.