Proteintech, 86584-2-RR, OMG Recombinant monoclonal antibody

Size: 20ul / 100ul The OMG (86584-2-RR) by Proteintech is a Recombinant antibody targeting OMG in WB, ELISA applications with reactivity to human samples 86584-2-RR targets OMG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse spinal cord tissue, rat spinal cord tissue, mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information OMG (oligodendrocyte myelin glycoprotein), also known as OMGP. It is expected to be located in cell membrane, the protein is mainly expressed in the central nervous system in both neurons and oligodendrocytes. The calculated molecular weight of OMG is 50 kDa, and o-glycosylated in its Ser/Thr-rich repeat domain. It is also a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system. Axonal regeneration in the adult spinal cord is thought to be at least partially blocked after injury by inhibitory myelin components, including Nogo, myelin associated glycoprotein (MAG) and oligodendrocyte-myelin glycoprotein (OMGP). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5825 Product name: Recombinant human OMGP protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-417 aa of NM_002544.5 Sequence: ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPS Predict reactive species Full Name: oligodendrocyte myelin glycoprotein Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: NM_002544.5 Gene Symbol: OMG Gene ID (NCBI): 4974 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23515 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.