Proteintech, 86588-2-RR, CD32 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD32 (86588-2-RR) by Proteintech is a Recombinant antibody targeting CD32 in WB, IF/ICC, ELISA applications with reactivity to human samples 86588-2-RR targets CD32 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, K-562 cells Positive IF/ICC detected in: U-937 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2713 Product name: Recombinant Human FCGR2A/CD32a protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 34-217 aa of NM_001136219.3 Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG Predict reactive species Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_001136219.3 Gene Symbol: CD32a Gene ID (NCBI): 2212 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12318-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.