Iright
BRAND / VENDOR: Proteintech

Proteintech, 86610-2-RR, CUEDC2 Recombinant monoclonal antibody

CATALOG NUMBER: 86610-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CUEDC2 (86610-2-RR) by Proteintech is a Recombinant antibody targeting CUEDC2 in WB, IHC, ELISA applications with reactivity to human samples 86610-2-RR targets CUEDC2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, HCT 116 cells, ACHN cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13847 Product name: Recombinant human CUEDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC000262 Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA Predict reactive species Full Name: CUE domain containing 2 Calculated Molecular Weight: 287 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000262 Gene Symbol: CUEDC2 Gene ID (NCBI): 79004 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H467 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924