Proteintech, 86622-1-RR, NUP153 Recombinant monoclonal antibody

Size: 20ul / 100ul The NUP153 (86622-1-RR) by Proteintech is a Recombinant antibody targeting NUP153 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86622-1-RR targets NUP153 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, A431 cells, K-562 cells, C2C12 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information NUP153 is an FG-repeat containing NUP, contains a high-affinity site for importin-β, localizes on the nucleoplasmic face of the nuclear pore and is required for assembly of the nuclear basket and import of a subset of nuclear proteins [PMID:18845677]. NUP153 also facilitates nuclear export of mRNA and ribonucleoprotein particles and may have additional functions within the nucleus [PMID:16195343]. The 53BP1-NUP153/importin-β pathway as an important aspect of the DDR network add to an emerging evidence of subcellular trafficking as an integral part of genome surveillance [PMID:22075984]. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5519 Product name: Recombinant human NUP153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1125-1475 aa of BC052965 Sequence: EEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK Predict reactive species Full Name: nucleoporin 153kDa Calculated Molecular Weight: 154 kDa Observed Molecular Weight: 160-170 kDa GenBank Accession Number: BC052965 Gene Symbol: NUP153 Gene ID (NCBI): 9972 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49790 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.