Product Description
Size: 20ul / 100ul
The LGR5 (86627-1-RR) by Proteintech is a Recombinant antibody targeting LGR5 in WB, ELISA applications with reactivity to human samples
86627-1-RR targets LGR5 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, BGC-823 cells, SGC-7901 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag31625 Product name: Recombinant human LGR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 824-907 aa of BC096324 Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL Predict reactive species
Full Name: leucine-rich repeat-containing G protein-coupled receptor 5
Calculated Molecular Weight: 907 aa, 100 kDa
Observed Molecular Weight: 100 kDa
GenBank Accession Number: BC096324
Gene Symbol: LGR5
Gene ID (NCBI): 8549
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: O75473
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924