Proteintech, 86650-2-RR, GPX3 Recombinant monoclonal antibody

Size: 20ul / 100ul The GPX3 (86650-2-RR) by Proteintech is a Recombinant antibody targeting GPX3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 86650-2-RR targets GPX3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information GPX3 (glutathione peroxidase 3) is also named as Plasma Glutathione Peroxidase. GPX3 can protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPX3 is secreted into plasma and like GPX1, is an 100 kDa homotetramer consisting of four identical 23 kDa subunits, each containing a selenocysteine residue at the active site. It can be detected a band of 20 kDa which is considered as the chain A of GPX3 (selenocysteine to glycine mutant). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5054 Product name: Recombinant human GPX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC050378 Sequence: MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASY Predict reactive species Full Name: glutathione peroxidase 3 (plasma) Calculated Molecular Weight: 226 aa, 26 kDa Observed Molecular Weight: 20-27 kDa GenBank Accession Number: BC050378 Gene Symbol: GPX3 Gene ID (NCBI): 2878 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.