Proteintech, 86661-3-RR, DHTKD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The DHTKD1 (86661-3-RR) by Proteintech is a Recombinant antibody targeting DHTKD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 86661-3-RR targets DHTKD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, MCF-7 cells, HepG2 cells, mouse liver tissue, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information DHTKD1 (Dehydrogenase E1 And Transketolase Domain Containing 1), also named as 2-aminoadipic 2-oxoadipic aciduria protein, OADC-E1, OADH-E1, is a lesser-studied E1 enzyme among the family of 2-oxoacid dehydrogenases (PMID: 32695416). DHTKD1 was expressed ubiquitously in various tissues and was proposed to localize to the mitochondria (PMID: 23141294). DHTKD1 plays a critical role in energy production in mitochondria, suppression of DHTKD1 leads to impaired mitochondrial biogenesis and increased cell apoptosis (PMID: 24076469). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26515 Product name: Recombinant human DHTKD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-197 aa of BC007955 Sequence: GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES Predict reactive species Full Name: dehydrogenase E1 and transketolase domain containing 1 Calculated Molecular Weight: 103 kDa Observed Molecular Weight: 103 kDa GenBank Accession Number: BC007955 Gene Symbol: DHTKD1 Gene ID (NCBI): 55526 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96HY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.