Proteintech, 86664-3-RR, Calpastatin Recombinant monoclonal antibody

Size: 20ul / 100ul The Calpastatin (86664-3-RR) by Proteintech is a Recombinant antibody targeting Calpastatin in WB, ELISA applications with reactivity to human samples 86664-3-RR targets Calpastatin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MDA-MB-231 cells, A549 cells, HaCaT cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Calpastatin (CAST) is an endogenous protein that specifically inhibits the activity of calpains, a family of calcium-dependent proteases involved in numerous cellular processes. The CAST gene encodes calpastatin, which contains multiple calpain-inhibiting domains that bind to the active site of calpain, preventing it from performing its functions. Calpastatin is found in the cytosol and plays a key role in regulating intracellular proteolysis, with malfunctions in the calpain-calpastatin system linked to various diseases, including autoimmune disorders and neurodegenerative conditions. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2897 Product name: Recombinant human CAST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC013579 Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK Predict reactive species Full Name: calpastatin Calculated Molecular Weight: 667 aa, 72 kDa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: BC013579 Gene Symbol: Calpastatin Gene ID (NCBI): 831 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20810 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.