Product Description
Size: 20ul / 100ul
The CXCL7/PPBP (86698-1-RR) by Proteintech is a Recombinant antibody targeting CXCL7/PPBP in WB, IF/ICC, ELISA applications with reactivity to human samples
86698-1-RR targets CXCL7/PPBP in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human peripheral blood platelets
Positive IF/ICC detected in: Transfected CHO-K1
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg3690 Product name: Recombinant Human CXCL7/PBP protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 59-128 aa of NM_002704.3 Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species
Full Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Calculated Molecular Weight: 14kDa
Observed Molecular Weight: 8-14 kDa
GenBank Accession Number: NM_002704.3
Gene Symbol: PPBP
Gene ID (NCBI): 5473
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P02775
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924