Iright
BRAND / VENDOR: Proteintech

Proteintech, 86722-1-RR, KPNA3 Recombinant monoclonal antibody

CATALOG NUMBER: 86722-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The KPNA3 (86722-1-RR) by Proteintech is a Recombinant antibody targeting KPNA3 in WB, ELISA applications with reactivity to human, mouse, rat samples 86722-1-RR targets KPNA3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, HeLa cells, Caco-2 cells, NIH/3T3 cells, PC-12 cells, HSC-t6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information KPNA3, karyopherin subunit alpha 3, also known as SRP1 or IPOA4. It is expected to be located in cytoplasm and nucleus, the protein is ubiquitous and highly expressed in heart, skeletal muscle. The calculated molecular weight of KPNA3 is 57 kDa. Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27755 Product name: Recombinant human KPNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species Full Name: karyopherin alpha 3 (importin alpha 4) Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 57-60 kDa GenBank Accession Number: BC017355 Gene Symbol: KPNA3 Gene ID (NCBI): 3839 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00505 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924