Proteintech, 86742-2-RR, ACAD8 Recombinant monoclonal antibody

Size: 20ul / 100ul The ACAD8 (86742-2-RR) by Proteintech is a Recombinant antibody targeting ACAD8 in WB, ELISA applications with reactivity to human samples 86742-2-RR targets ACAD8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The acyl-CoA dehydrogenases (ACAD) (EC 1.3.99) are a family of nuclear-encoded mitochondrial enzymes involved in the metabolism of fatty acids and branched chain amino acids (PMID: 13295225). The eighth member of this family, ACAD8, catalyzes the conversion of isobutyryl-CoA to methacrylyl-CoA in valine catabolism (PMID: 12359132). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9967 Product name: Recombinant human ACAD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-415 aa of BC001964 Sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE Predict reactive species Full Name: acyl-Coenzyme A dehydrogenase family, member 8 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC001964 Gene Symbol: ACAD8 Gene ID (NCBI): 27034 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UKU7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.