Proteintech, 86759-3-RR, FABP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The FABP1 (86759-3-RR) by Proteintech is a Recombinant antibody targeting FABP1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 86759-3-RR targets FABP1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, pig liver tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7278 Product name: Recombinant mouse FABP1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-127 aa of NM_017399.4 Sequence: NFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI Predict reactive species Full Name: fatty acid binding protein 1, liver Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: NM_017399.4 Gene Symbol: Fabp1 Gene ID (NCBI): 14080 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12710 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.