Iright
BRAND / VENDOR: Proteintech

Proteintech, 86775-3-RR, HFE2/Hemojuvelin Recombinant monoclonal antibody

CATALOG NUMBER: 86775-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HFE2/Hemojuvelin (86775-3-RR) by Proteintech is a Recombinant antibody targeting HFE2/Hemojuvelin in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86775-3-RR targets HFE2/Hemojuvelin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, human platelets, human skeletal muscle tissue, human heart tissue, mouse liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HFE2, also known as Hemojuvelin (HJV), is a GPI-anchored protein that binds to new proteins and bone morphogenetic proteins (BMP2 and BMP4) and can be released from the cell membrane. HFE2 plays a key role in the regulation of hepcidin, which regulates the absorption and recycling of iron.(PMID: 17331953; PMID: 17938254) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2354 Product name: Recombinant human HFE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-426 aa of BC017926 Sequence: MQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ Predict reactive species Full Name: hemochromatosis type 2 (juvenile) Calculated Molecular Weight: 426 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC017926 Gene Symbol: HFE2 Gene ID (NCBI): 148738 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6ZVN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924