Product Description
Size: 20ul / 100ul
The FABP1 (86792-1-RR) by Proteintech is a Recombinant antibody targeting FABP1 in WB, ELISA applications with reactivity to human, mouse samples
86792-1-RR targets FABP1 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HepG2 cells, mouse liver tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg7273 Product name: Recombinant human FABP1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-127 aa of NM_001443.3 Sequence: SFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Predict reactive species
Full Name: fatty acid binding protein 1, liver
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: NM_001443.3
Gene Symbol: FABP1
Gene ID (NCBI): 2168
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P07148
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924