Iright
BRAND / VENDOR: Proteintech

Proteintech, 86792-1-RR, FABP1 Recombinant monoclonal antibody

CATALOG NUMBER: 86792-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The FABP1 (86792-1-RR) by Proteintech is a Recombinant antibody targeting FABP1 in WB, ELISA applications with reactivity to human, mouse samples 86792-1-RR targets FABP1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7273 Product name: Recombinant human FABP1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-127 aa of NM_001443.3 Sequence: SFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Predict reactive species Full Name: fatty acid binding protein 1, liver Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: NM_001443.3 Gene Symbol: FABP1 Gene ID (NCBI): 2168 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924