Iright
BRAND / VENDOR: Proteintech

Proteintech, 86795-1-RR, AP3S2 Recombinant monoclonal antibody

CATALOG NUMBER: 86795-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The AP3S2 (86795-1-RR) by Proteintech is a Recombinant antibody targeting AP3S2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86795-1-RR targets AP3S2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HepG2 cells, mouse testis tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information AP3S2 is a 22-kDa protein that belongs to the adaptor complexes small subunit family. AP3S2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-3 complex is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7565 Product name: Recombinant human AP3S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC002785 Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV Predict reactive species Full Name: adaptor-related protein complex 3, sigma 2 subunit Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC002785 Gene Symbol: AP3S2 Gene ID (NCBI): 10239 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P59780 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924