Iright
BRAND / VENDOR: Proteintech

Proteintech, 86815-1-RR, HAT1 Recombinant monoclonal antibody

CATALOG NUMBER: 86815-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HAT1 (86815-1-RR) by Proteintech is a Recombinant antibody targeting HAT1 in WB, IF/ICC, ELISA applications with reactivity to human samples 86815-1-RR targets HAT1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells, PC-12 cells Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1952 Product name: Recombinant human HAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-419 aa of BC018682 Sequence: MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE Predict reactive species Full Name: histone acetyltransferase 1 Calculated Molecular Weight: 419 aa, 50 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC018682 Gene Symbol: HAT1 Gene ID (NCBI): 8520 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924