Proteintech, 86817-1-RR, ACP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ACP1 (86817-1-RR) by Proteintech is a Recombinant antibody targeting ACP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 86817-1-RR targets ACP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells, K-562 cells, RAW 264.7 cells, NIH/3T3 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Acid phosphatase 1 (ACP1) is a low-molecular-weight phosphotyrosine protein phosphatase known to participate in various cellular processes, including signal transduction, proliferation, and metabolism. It functions by dephosphorylating tyrosine-phosphorylated proteins, thereby modulating receptor-mediated signaling pathways. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17539 Product name: Recombinant human ACP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-102 aa of BC007422 Sequence: GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR Predict reactive species Full Name: acid phosphatase 1, soluble Calculated Molecular Weight: 158 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC007422 Gene Symbol: ACP1 Gene ID (NCBI): 52 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24666 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.