Proteintech, 86839-3-RR, RAB34 Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB34 (86839-3-RR) by Proteintech is a Recombinant antibody targeting RAB34 in WB, ELISA applications with reactivity to human, mouse, rat samples 86839-3-RR targets RAB34 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, A549 cells, A431 cells, U2OS cells, rat testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RAB34, a Rab protein family member, is involved in repositioning of lysosomes, activation of micropinocytosis, and protein transport. RAB34 is aberrantly expressed in various cancers and exhibits oncogenic properties. Recently, Rab34 is identified as a ciliary protein. Rab34 is required for internal assembly of cilia but not for cilia built on the cell surface. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26696 Product name: Recombinant human RAB34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-251 aa of BC016841 Sequence: QAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP Predict reactive species Full Name: RAB34, member RAS oncogene family Calculated Molecular Weight: 251 aa, 28 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC016841 Gene Symbol: RAB34 Gene ID (NCBI): 83871 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BZG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.