Proteintech, 86843-1-RR, BUB1 Recombinant monoclonal antibody

Size: 20ul / 100ul The BUB1 (86843-1-RR) by Proteintech is a Recombinant antibody targeting BUB1 in WB, ELISA applications with reactivity to human samples 86843-1-RR targets BUB1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, 8305C cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Bub1 is an evolutionarily conserved mitotic checkpoint control protein that is present in diverse organisms including yeast and humans. Bub1 is a serine/threonine protein kinase and is required for recruitment of Mad1, Mad2, Bub3, and CENP-E to kinetochores. Full-length Bub1 protein was cleaved to an 45 kDa fragment and an intermediate fragment of 90 kDa, only detected at early stages of apoptosis execution, indicating cleavage of Bub1 in the amino- and carboxy-terminal regions of the protein(PMID:15818396). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4138 Product name: Recombinant human BUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 785-1083 aa of BC028201 Sequence: KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS Predict reactive species Full Name: budding uninhibited by benzimidazoles 1 homolog (yeast) Calculated Molecular Weight: 1085 aa, 122 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC028201 Gene Symbol: BUB1 Gene ID (NCBI): 699 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43683 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.