Proteintech, 86852-2-RR, FBP17 Recombinant monoclonal antibody

Size: 20ul / 100ul The FBP17 (86852-2-RR) by Proteintech is a Recombinant antibody targeting FBP17 in WB, IF/ICC, ELISA applications with reactivity to human samples 86852-2-RR targets FBP17 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, MG-63 cells, Raji cells, MKN-45 cells, 143B cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FBP17 (formin-binding protein 17) is a new dynamin-associating molecule consisting of several functional domains, including an N-terminal EFC domain and an SH3 domain at the C-terminus. FBP17 is involved in dynamin-mediated endocytosis and has been reported to be required for invadopodia formation and tumor cell invasion. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25784 Product name: Recombinant human FNBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-241 aa of BC101755 Sequence: AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQV Predict reactive species Full Name: formin binding protein 1 Observed Molecular Weight: 80-85 kDa GenBank Accession Number: BC101755 Gene Symbol: FBP17 Gene ID (NCBI): 23048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96RU3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.