Proteintech, 86866-1-RR, DOCK10 Recombinant monoclonal antibody

Size: 20ul / 100ul The DOCK10 (86866-1-RR) by Proteintech is a Recombinant antibody targeting DOCK10 in WB, IP, ELISA applications with reactivity to human samples 86866-1-RR targets DOCK10 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information DOCK10 (Dedicator of Cytokinesis 10) is a protein-coding gene that belongs to the DOCK family of guanine nucleotide exchange factors (GEFs). It is involved in regulating the activity of Rho GTPases, particularly Rac1 and Cdc42, which play crucial roles in various cellular processes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10486 Product name: Recombinant human DOCK10 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 194-542 aa of BC015018 Sequence: AVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISKATPALPTVSISSSAEV Predict reactive species Full Name: dedicator of cytokinesis 10 Calculated Molecular Weight: 542 aa, 62 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: BC015018 Gene Symbol: DOCK10 Gene ID (NCBI): 55619 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96BY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.