Iright
BRAND / VENDOR: Proteintech

Proteintech, 86877-1-RR, GLYR1 Recombinant monoclonal antibody

CATALOG NUMBER: 86877-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GLYR1 (86877-1-RR) by Proteintech is a Recombinant antibody targeting GLYR1 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 86877-1-RR targets GLYR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information GlyR1 (glyoxylate/successful semi-Aldehyde Reductase 1) is a plant-specific NADPH- dependent reductase, which mainly locates in cytoplasm. It was originally regarded as "glyoxal/succinate semialdehyde reductase", which can reduce glyoxylate, an intermediate product of photorespiration, to glycolate, and also reduce succinate semialdehyde produced by GABA metabolism to γ-hydroxybutyric acid, thus eliminating active aldehydes and alleviating oxidative damage caused by abiotic stress. In invasive breast cancer cells, GLYR1 was detected to "flip" from the nucleus to the cell membrane (ecto-GLYR1) and became a new tumor-specific antigen. Humanized antibody and CAR-NK/CAR-T systems have been established for the membrane epitope, and will soon enter the clinical safety assessment. This means that GLYR1 itself can also be used as a "membrane target antigen" for precise tumor treatment. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6637 Product name: Recombinant human N-PAC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-484 aa of BC064940 Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH Predict reactive species Full Name: cytokine-like nuclear factor n-pac Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC064940 Gene Symbol: N-PAC Gene ID (NCBI): 84656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q49A26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924