Proteintech, 86907-3-RR, CXCL7/PPBP Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCL7/PPBP (86907-3-RR) by Proteintech is a Recombinant antibody targeting CXCL7/PPBP in WB, ELISA applications with reactivity to mouse samples 86907-3-RR targets CXCL7/PPBP in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse serum Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2806 Product name: Recombinant Mouse PPBP protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 48-109 aa of NM_023785.3 Sequence: IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI Predict reactive species Full Name: pro-platelet basic protein Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: NM_023785.3 Gene Symbol: Ppbp Gene ID (NCBI): 57349 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9EQI5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.