Product Description
Size: 20ul / 100ul
The GM-CSF (86923-1-RR) by Proteintech is a Recombinant antibody targeting GM-CSF in WB, ELISA applications with reactivity to rat samples
86923-1-RR targets GM-CSF in WB, ELISA applications and shows reactivity with rat samples.
Tested Applications
Positive WB detected in: Transfected with Rat GM-CSF/CSF2 HEK-293T cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
Gm-csf, also known as Csf2, is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, NK cells, endothelial cells and fibroblasts that functions as a cytokine. Gm-csf was first characterized as a hematopoietic growth factor that stimulates the proliferation of myeloid cells from bone-marrow progenitors. Gm-csf is now recognized as an important activating and differentiation factor for immune cells, and is essential for a wide range of biological processes in both innate and adaptive immunity. Gm-csf has been shown to protect against pulmonary infection and intestinal inflammation, and it is necessary for normal pulmonary and colon homeostasis.
Specification
Tested Reactivity: rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg3202 Product name: Recombinant Rat GM-CSF protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 18-144 aa of NM_053852.1 Sequence: APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK Predict reactive species
Full Name: colony stimulating factor 2 (granulocyte-macrophage)
Calculated Molecular Weight: 17 kDa
GenBank Accession Number: NM_053852.1
Gene Symbol: Csf2
Gene ID (NCBI): 116630
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P48750
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924