Proteintech, 86925-1-RR, MER34 Recombinant monoclonal antibody

Size: 20ul / 100ul The MER34 (86925-1-RR) by Proteintech is a Recombinant antibody targeting MER34 in WB, ELISA applications with reactivity to human, mouse, rat samples 86925-1-RR targets MER34 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, mouse lung tissue, SW480 cells, HCT 116 cells, Caco-2 cells, mouse colon tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ERVMER34 (also known as ERVMER34-1) is a human endogenous retrovirus (ERV) envelope protein that has attracted much attention in tumor immunotherapy research in recent years. It is significantly highly expressed in a variety of solid tumors, including colorectal cancer, bladder cancer, lung cancer, breast cancer, and endometrial cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6066 Product name: Recombinant human MER34 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-488 aa of NM_001242690.2 Sequence: LLAPVFRTLSILTNQSNCWLCEHLDNAEQPELVFVPASASTWWTYSGQWMYERVWYPQAEVQNHSTSSYRKVTWHWEASMEAQGLSFAQVRLLEGNFSLCVENKNGSGPFLGNIPKQYCNQILWFDSTDGTFMPSIDVTNESRNDDDDTSVCLGTRQCSWFAGCTNRTWNSSAVPLIGLPNTQDYKWVDRNSGLTWSGNDTCLYSCQNQTKGLLYQLFRNLFCSYGLTEAHGKWRCADASITNDKGHDGHRTPTWWLTGSNLTLSVNNSGLFFLCGNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGKQCCLYINYSEEIKSNIQRLHEASENLKNVPLLDWQGIFAKVGDWFR Predict reactive species Full Name: endogenous retrovirus group MER34 member 1, envelope Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_001242690.2 Gene Symbol: ERVMER34-1 Gene ID (NCBI): 100288413 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.