Proteintech, 86943-1-RR, TOMM40L Recombinant monoclonal antibody

Size: 20ul / 100ul The TOMM40L (86943-1-RR) by Proteintech is a Recombinant antibody targeting TOMM40L in WB, ELISA applications with reactivity to human, mouse, rat samples 86943-1-RR targets TOMM40L in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, Caco-2 cells, HeLa cells, HepG2 cells, HT-1080 cells, mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TOMM40L (Mitochondrial import receptor subunit TOM40B) is a potential channel-forming protein implicated in the import of protein precursors into mitochondria. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9401 Product name: Recombinant human TOMM40L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC014946 Sequence: MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFHCGFSITVG Predict reactive species Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast)-like Calculated Molecular Weight: 308 aa, 34 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC014946 Gene Symbol: TOMM40L Gene ID (NCBI): 84134 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q969M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.