Proteintech, 86948-1-RR, Cathepsin S Recombinant monoclonal antibody

Size: 20ul / 100ul The Cathepsin S (86948-1-RR) by Proteintech is a Recombinant antibody targeting Cathepsin S in WB, IF/ICC, ELISA applications with reactivity to human samples 86948-1-RR targets Cathepsin S in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells, THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cathepsin S (CTSS) is a cysteine protease that plays an important role in extracellular matrix degradation and remodeling, antigen presentation, inflammation, and angiogenesis; it has been identified as a radiation response gene. In malignant tumors, CTSS induces tumor proliferation, invasion and metastasis through various mechanisms. CTSS proteins could be detected in two forms, pro-CTSS (35-37 kDa) and active CTSS (25 kDa) (PMID: 30006610, PMID: 34208434). And in this publication, it was also reporeted that active CTSS was expressed at higher levels than pro-CTSS in the lysate (PMID: 34208434). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25881 Product name: Recombinant human CTSS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-296 aa of BC002642 Sequence: GCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLV Predict reactive species Full Name: cathepsin S Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 25 kDa, 37 kDa GenBank Accession Number: BC002642 Gene Symbol: CTSS Gene ID (NCBI): 1520 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25774 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.