Iright
BRAND / VENDOR: Proteintech

Proteintech, 86954-1-RR, RCOR1 Recombinant monoclonal antibody

CATALOG NUMBER: 86954-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RCOR1 (86954-1-RR) by Proteintech is a Recombinant antibody targeting RCOR1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86954-1-RR targets RCOR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, MOLT-4 cells, Neuro-2a cells, C6 cells, PC-12 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information RCOR1, also named as REST corepressor 1, is a 485 amino acid protein, which belongs to the CoREST family. RCOR1 is a essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. The calculated molecular weight of RCOR1 is a 53 kDa, but the phosphorylated RCOR1 is about 60-65 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26770 Product name: Recombinant human RCOR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 245-310 aa of NM_015156 Sequence: MRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKP Predict reactive species Full Name: REST corepressor 1 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_015156 Gene Symbol: RCOR1 Gene ID (NCBI): 23186 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UKL0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924