Proteintech, 86975-4-RR, DNAJC5B Recombinant monoclonal antibody

Size: 20ul / 100ul The DNAJC5B (86975-4-RR) by Proteintech is a Recombinant antibody targeting DNAJC5B in WB, ELISA applications with reactivity to human, mouse, rat samples 86975-4-RR targets DNAJC5B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information DNAJC5B encodes cysteine string proteins (CSP) beta. CSPs belong to the DnaJ-like chaperone family and play an important role in regulated exocytosis in neurons and endocrine cells. Mammals express three CSP proteins, α, β, γ. In contrast to the CSPα which is ubiquitously expressed, CSPβ is restricted to testis and auditory hair cell neurons. The predicted MW of DNAJC5B is around 22 kDa, while some modified forms exist (PMID: 17034881) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10744 Product name: Recombinant human DNAJC5B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-199 aa of BC016742 Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 5 beta Calculated Molecular Weight: 199 aa, 22 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC016742 Gene Symbol: DNAJC5B Gene ID (NCBI): 85479 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UF47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.