Proteintech, 86977-4-RR, Calponin Recombinant monoclonal antibody

Size: 20ul / 100ul The Calponin (86977-4-RR) by Proteintech is a Recombinant antibody targeting Calponin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 86977-4-RR targets Calponin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse bladder tissue, rat bladder tissue Positive IHC detected in: human appendix tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kDa protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species Full Name: calponin 1, basic, smooth muscle Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC022015 Gene Symbol: Calponin Gene ID (NCBI): 1264 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.