Proteintech, 86979-1-RR, ID3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ID3 (86979-1-RR) by Proteintech is a Recombinant antibody targeting ID3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86979-1-RR targets ID3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, Ramos cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information The helix-loop-helix (HLH) family of transcription factors plays a central role in the regulation of cell growth, differentiation and tumourigenesis. Members of the Id (inhibitor of DNA binding) class of these nuclear proteins are able to heterodimerise with and thereby antagonise the functions of other transcription factors of this family. Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3, synonym: HEIR-1) is a member of the ID family of HLH proteins, which lacks a basic DNA-binding domain and inhibits transcription through formation of nonfunctional dimers that are incapable of binding to DNA. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0588 Product name: Recombinant human ID3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003107 Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH Predict reactive species Full Name: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein Calculated Molecular Weight: 119 aa, 13 kDa Observed Molecular Weight: 13-15 kDa GenBank Accession Number: BC003107 Gene Symbol: ID3 Gene ID (NCBI): 3399 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q02535 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.