Iright
BRAND / VENDOR: Proteintech

Proteintech, 86993-3-RR, KRR1 Recombinant monoclonal antibody

CATALOG NUMBER: 86993-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The KRR1 (86993-3-RR) by Proteintech is a Recombinant antibody targeting KRR1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86993-3-RR targets KRR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A-204 cells, PANC-1 cells, Jurkat cells, Daudi cells, RAW 264.7 cells, PC-12 cells Positive IF/ICC detected in: RAW 264.7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information KRR1 (also known as RIP-1) is a key assembly factor in the biogenesis of 40S precursor ribosomes (90S). As a rate-limiting node in ribosome biogenesis, its expression level reflects overall ribosome production activity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3464 Product name: Recombinant human KRR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC026107 Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK Predict reactive species Full Name: KRR1, small subunit (SSU) processome component, homolog (yeast) Calculated Molecular Weight: 381 aa, 44 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC026107 Gene Symbol: KRR1 Gene ID (NCBI): 11103 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13601 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924