Proteintech, 86993-3-RR, KRR1 Recombinant monoclonal antibody

Size: 20ul / 100ul The KRR1 (86993-3-RR) by Proteintech is a Recombinant antibody targeting KRR1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86993-3-RR targets KRR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A-204 cells, PANC-1 cells, Jurkat cells, Daudi cells, RAW 264.7 cells, PC-12 cells Positive IF/ICC detected in: RAW 264.7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information KRR1 (also known as RIP-1) is a key assembly factor in the biogenesis of 40S precursor ribosomes (90S). As a rate-limiting node in ribosome biogenesis, its expression level reflects overall ribosome production activity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3464 Product name: Recombinant human KRR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC026107 Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK Predict reactive species Full Name: KRR1, small subunit (SSU) processome component, homolog (yeast) Calculated Molecular Weight: 381 aa, 44 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC026107 Gene Symbol: KRR1 Gene ID (NCBI): 11103 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13601 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.