Iright
BRAND / VENDOR: Proteintech

Proteintech, 87009-2-RR, ELK1 Recombinant monoclonal antibody

CATALOG NUMBER: 87009-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ELK1 (87009-2-RR) by Proteintech is a Recombinant antibody targeting ELK1 in WB, IF/ICC, ELISA applications with reactivity to human samples 87009-2-RR targets ELK1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells, Jurkat cells, Raji cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ELK1 is a nuclear transcription factor of the ETS-domain family and the ternary complex factor (TCF) sub-family. It binds to purine-rich DNA sequences and forms a ternary complex with serum response factor (SRF) on the serum response element (SRE) located in the promoter regions of immediate early genes such as FOS and IER2. Upon activation of the JNK or MAPK/ERK signaling cascades, ELK1 is phosphorylated and rapidly induces target-gene transcription, thereby regulating cell proliferation, differentiation, and survival. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26683 Product name: Recombinant human ELK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-320 aa of BC056150 Sequence: TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE Predict reactive species Full Name: ELK1, member of ETS oncogene family Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 58-60 kDa GenBank Accession Number: BC056150 Gene Symbol: ELK1 Gene ID (NCBI): 2002 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19419 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924