Proteintech, 87040-2-RR, MYD88 Recombinant monoclonal antibody

Size: 20ul / 100ul The MYD88 (87040-2-RR) by Proteintech is a Recombinant antibody targeting MYD88 in WB, ELISA applications with reactivity to human, rat samples 87040-2-RR targets MYD88 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells, K-562 cells, Raji cells, HepG2 cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MYD88 is a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. MYD88 is the key adaptor protein for the interleukin-1 receptor (IL-1R) and most Toll-like receptors (TLRs), which are essential for innate immunity and pathogen-associated molecular pattern recognition. Mutations in the MyD88 gene lead to the development of cancer in humans and mice suggesting that MyD88 also plays a cell autonomous role in tissue homeostasis. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19770 Product name: Recombinant human MYD88 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC013589 Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL Predict reactive species Full Name: myeloid differentiation primary response gene (88) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC013589 Gene Symbol: MYD88 Gene ID (NCBI): 4615 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99836 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.