Iright
BRAND / VENDOR: Proteintech

Proteintech, 87050-1-RR, CD300a Recombinant monoclonal antibody

CATALOG NUMBER: 87050-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CD300a (87050-1-RR) by Proteintech is a Recombinant antibody targeting CD300a in WB, ELISA applications with reactivity to mouse, rat samples 87050-1-RR targets CD300a in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CD300a is a transmembrane protein with an immunoglobulin (Ig)V-like extracellular domain and a cytoplasmic tail containing immunoreceptor tyrosine-based inhibitory motifs (ITIMs), providing the receptor with an inhibitory capacity. The relevance of the CD300a molecule in several pathological conditions has been highlighted by multiple studies. (PMID: 37762055) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2675 Product name: recombinant mouse Cd300a protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 28-183 aa of Sequence: LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR Predict reactive species Full Name: CD300A antigen Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 60-70 kDa Gene Symbol: Cd300a Gene ID (NCBI): 217303 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6SJQ0-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924