Iright
BRAND / VENDOR: Proteintech

Proteintech, 87051-3-RR, SOX10 Recombinant monoclonal antibody

CATALOG NUMBER: 87051-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SOX10 (87051-3-RR) by Proteintech is a Recombinant antibody targeting SOX10 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 87051-3-RR targets SOX10 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MDA-MB-453 cells, A375 cells, SW480 cells, C6 cells Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-65 kDa. (PMID: 23799842, 39982575) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag38090 Product name: Recombinant human SOX10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 267-466 aa of BC002824 Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP Predict reactive species Full Name: SRY (sex determining region Y)-box 10 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50-65 kDa GenBank Accession Number: BC002824 Gene Symbol: SOX10 Gene ID (NCBI): 6663 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56693 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924