Proteintech, 87075-1-RR, KIF3C Recombinant monoclonal antibody

Size: 20ul / 100ul The KIF3C (87075-1-RR) by Proteintech is a Recombinant antibody targeting KIF3C in WB, ELISA applications with reactivity to human, mouse samples 87075-1-RR targets KIF3C in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, SW480 cells, HepG2 cells, Y79 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information KIF3C(Kinesin Family Member 3C) is a member of Kinesin-2 family, which belongs to microtubule-dependent motor protein. It can generate mechanical energy by hydrolyzing ATP, and regulate many processes such as intracellular transport, cytoskeleton dynamics, cell division and migration. It plays an important role in nervous system, tumor and other tissues, and has gradually become a hot target of cancer and neurodegenerative diseases in recent years. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5619 Product name: Recombinant human KIF3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-360 aa of BC042486 Sequence: MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTFDAVYDASSKQADLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKEPGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGSTHMNEVSSRSHAIFIITVECSERGSDGQDHIRVGKLNLVDLAGSERQNKAGPNTAGGAATPSSGGGGGGGGSGGGAGGERPKEASKINLSLSALGNVIAALAGNRSTHIPYRDSKLTRLLQDSLGGNAKTIMVATLGPASHSYDESLSTLRFANRAKNIKNK Predict reactive species Full Name: kinesin family member 3C Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC042486 Gene Symbol: KIF3C Gene ID (NCBI): 3797 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14782 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.