Proteintech, 87117-4-RR, MINPP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The MINPP1 (87117-4-RR) by Proteintech is a Recombinant antibody targeting MINPP1 in WB, IF/ICC, ELISA applications with reactivity to human samples 87117-4-RR targets MINPP1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SW480 cells, K-562 cells, HEK-293 cells, HepG2 cells, PANC-1 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MINPP1 (multiple inositol-polyphosphate phosphatase 1), also known as MIPP and MINPP2, is an enzyme that catalyzes the removal of the 3-phosphate group from inositol phosphate substrates. It plays a crucial role in the metabolism of inositol polyphosphates, which are important second messengers in cellular signaling pathways. MINPP1 has been implicated in various diseases, including certain types of cancer, where its expression levels may be associated with tumor progression and differentiation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34998 Product name: Recombinant human MINPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-339 aa of BC032504 Sequence: MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTL Predict reactive species Full Name: multiple inositol polyphosphate histidine phosphatase, 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC032504 Gene Symbol: MINPP1 Gene ID (NCBI): 9562 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UNW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.