Proteintech, 87123-1-RR, GIPR Recombinant monoclonal antibody

Size: 20ul / 100ul The GIPR (87123-1-RR) by Proteintech is a Recombinant antibody targeting GIPR in WB, ELISA applications with reactivity to human, rat samples 87123-1-RR targets GIPR in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, rat heart tissue, Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6484 Product name: Recombinant human GIPR protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-138 aa of NM_000164.3 Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Predict reactive species Full Name: gastric inhibitory polypeptide receptor Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: NM_000164.3 Gene Symbol: GIPR Gene ID (NCBI): 2696 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48546 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.