Iright
BRAND / VENDOR: Proteintech

Proteintech, 87151-1-RR, CHMP2B Recombinant monoclonal antibody

CATALOG NUMBER: 87151-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CHMP2B (87151-1-RR) by Proteintech is a Recombinant antibody targeting CHMP2B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87151-1-RR targets CHMP2B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293T cells, MCF-7 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2-2, belongs to the chromatin-modifying protein / charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which is involved in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS-negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3222 Product name: Recombinant human CHMP2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-213 aa of BC001553 Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Predict reactive species Full Name: chromatin modifying protein 2B Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC001553 Gene Symbol: CHMP2B Gene ID (NCBI): 25978 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UQN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924