Product Description
Size: 20ul / 100ul
The ATP6V1F (87157-1-RR) by Proteintech is a Recombinant antibody targeting ATP6V1F in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
87157-1-RR targets ATP6V1F in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, HeLa cells, A549 cells, Jurkat cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue
Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Background Information
ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species
Full Name: ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Calculated Molecular Weight: 119 aa, 13 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC107854
Gene Symbol: ATP6V1F
Gene ID (NCBI): 9296
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q16864
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924